PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 1009aa    MW: 110857 Da    PI: 5.9788
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30083.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.31.7e-29638688252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  KHN30083.1 638 EKNVSLSVLQQYFSGSLKDAAKNIGVCPTTLKRICRQHGIPRWPSRKINKV 688
                 89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166622708IPR003035RWP-RK domain
PfamPF020425.4E-26640688IPR003035RWP-RK domain
SuperFamilySSF542772.39E-21905994No hitNo description
SMARTSM006661.2E-18909991IPR000270PB1 domain
PROSITE profilePS5174518.198909991IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.6E-22910991No hitNo description
PfamPF005643.2E-14912990IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1009 aa     Download sequence    Send to blast
MEYPFSPKDR VIGDWQSSGA QLEGSASLDG RMSNSISEDM PNSFSELMNF DTYAGLCYSP  60
SITDQILANE LPSFAPLSYP LPDGFNPVQL NSGQCCMSGV GRNNNDTENS SLYGEKVVCQ  120
QMDTLLGFLN DTNEANNLNS KLKINVSSQH LNNSDTGNYM MSRPPGLSLD ERMLRALSFF  180
KESAGGGILA QVWVPIKDGD QFILSTSEQP YLLDQMLAGY REVSRTFTFS AEGKSGCSLG  240
LPGRVFTSKV PEWTSNVGYY SMSEYLRFEH AINHKVCGSI AFPIFDLHSE LPCCAVLELV  300
TTNEKPDFDR ELEIVCRALQ ACFYFSSVTS LSALFACLTT SHVESDVEGS NDKCIYHGFL  360
QLVNLRTAKP LRCLPQCLSN NKKATLTEIV DVLRSVCHAH RLPLGLTWIP CCFTECSRGE  420
ASSIRIEGGH STSRGKNILC LEESACYITD RAMGGFVRAC MEHRLEEGKG IAGKALQSNH  480
PFFYPDVKTY DISEYPLVHH ARKYNLNAAV AIRLRSTYTN DDDYILEFFL PVNMKGSSEQ  540
QLLLDNLSGT MQRICSSLRT VSETELSGME SLAVGLGKKN APSFFPLSSR NSAIPLINGD  600
CDSVQKATNL RDNEIESSPN QERNGSKRQV QKNRSTSEKN VSLSVLQQYF SGSLKDAAKN  660
IGVCPTTLKR ICRQHGIPRW PSRKINKVNR SLKKIQTVLD SVQGVEGGLK FDPSMGAFVA  720
GGSIIQEIDA HKSTIKDPVP VAQDAFSVRP APCSEGENFS IKLEGKLKKT NVSSVNYSED  780
SKSMAINDGS CQTASLCTKV QDCPEQACLG SVLAKEHDKR ILNKGGLSVE KFKRNIVGQS  840
SKTLIGDEMD IGVDGDDGVV ERNHPTSSSL IDSSNGSGSM MHSSSSGSQS FKNQDQSKVK  900
STIVDSRSKL IVKATYREDT IRFTFDPCAG CFSLYEEVAA RFKLQNGLFQ LKYLDDEEEW  960
VMLVNNADLQ ECIEILDDIG TRSVRFLVRD MPSVLGSSGS SNSYLGGSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283180.0EU028318.1 Glycine max clone BAC gmw1-45b2 genomic sequence.
GenBankEU0283190.0EU028319.1 Glycine max clone BAC gmw1-91g6 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595076.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595077.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595078.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595079.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_014621587.10.0PREDICTED: protein NLP8 isoform X1
TrEMBLA0A0B2RDY70.0A0A0B2RDY7_GLYSO; Protein NLP8
STRINGGLYMA13G42160.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]